Coiled-coil domain-containing protein 135

This protein is characterized by the presence of two domains.[8]

• Nuclear localization sequence with a Score of 4 in the amino acids 265–279. The amino acid sequence for this region is:

KKQQEIRAQEKKRLR

• Transglutaminase-like family with an E Value of 0.0018 in the amino acids 149–308. The amino acid sequence for this region is:

CAQFVSDFLTMVPLPDPLKPPSHLYSSTTVLKYQKGNCFDFSTLLCSMLIGSGYDAYCVNGYGSLDLCHMDLTREVCPLTVKPKETIKKEEK VLPKKYTIKPPRDLCSRFEQEQEVKKQQEIRAQEKKRLREEEERLMEAEKAKPDALHGLRVHSWVLVL

The protein has 17 predicted alpha helices sites, a characteristic of coiled-coil proteins, and 1 predicted beta-pleated sheet. The following image shows the predicted regions of alpha helices and beta pleated sheets by two programs STRAP[9] and Quickphyre:[10] Note: the consensus secondary structures are shown. This was carried out by constructing a multiple sequence alignment of the proteins with their secondary structures (as shown below). The predicted regions were then cross checked with the Quickphyre Program.

A sequence annotation of CCDC135.

LRRC57 is exceedingly well conserved, as shown in the sequence annotation to the right. The sequence annotation was created using 20 orthologs shown in the table below and was prepared using ClustalX2[11] and ClustalW (a tool at Biology Workbench).[12]

The following table provides a few details on orthologs of the human version of CCDC135. These orthologs were gathered from BLAT.[13] and BLAST searches[14]

• Molecular weight: 103502.53 = 103484.53 + 18 kDa
• Isoelectric point: 5.358000
• Transmembrane helices: None
• Post-translation modifications:[15]

Chloroplast transit peptides: None

Signal pepties: Yes [8]

Nuclear Localization Sequence: KKQQEIRAQEKKRLR

C-mannosylation sites: None (However, 14 sites with scores lower than the threshold were predicted.[16])

Mitochondrial targeting: None

N-glycosylation sites: Yes

Sequence gi|223941912 at positions 100 and 493 with potentials of 0.7200 and 0.6031 receptively.

CCDC135 is predicted to be a Cytosol/Nuclear protein[17] with no transmembrane spans or segments. It is predicted to contain at least 56 specific phosphorylation sites[18] which include: 20 Protein Kinase C Phosphorylation sites, 11 Casein Kinase II Phosphorylation sites, and 8 cAMP/cGMP Dependent Phosphorylation sites. The amino acid sequence is also predicted to contain 10 sumoylation[19] sites at positions K236, K236, K45, K773, K499, K679, K249, K167, K540, K445, and K292.